DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and ct

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster


Alignment Length:443 Identity:106/443 - (23%)
Similarity:146/443 - (32%) Gaps:141/443 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TKTEPGLVGLSSNQQQQQQQQ-------------------------------SQQSNAGMNSGGQ 40
            |:|||     |:..|||.|||                               |:::|.|.|...|
  Fly   312 TRTEP-----SATTQQQHQQQDTEDLEENKDAGEASLNVSNNHNTTDSNNSCSRKNNNGGNESEQ 371

  Fly    41 ------------NNGPNPNGNGNVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNNNNNGSQLCA 93
                        ||..|.:.|.|..|...|......||.:.:..|......||||||...:.|.|
  Fly   372 HVASSAEDDDCANNNTNTSNNNNTSNTATSNTNNNNNNNSSSGNSEKRKKKNNNNNNGQPAVLLA 436

  Fly    94 GCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGN------ 152
            ...|.|  :.||..|..|..::       ...|.::..   .:.:|.:.::..:||...      
  Fly   437 AKDKEI--KALLDELQRLRAQE-------QTHLVQIQR---LEEHLEVKRQHIIRLEARLDKQQI 489

  Fly   153 -------TGYCAACS--------------KVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDR 196
                   |...||.|              |:..|.|..|.|.:|                  .|.
  Fly   490 NEALAEATALSAAASTNNNNNSQSSDNNKKLNTAAERPMDASSN------------------ADL 536

  Fly   197 FYLCENKILCEYDYEER----LVFASMA-NHPMLKRHVSSLGQGSPTGAAGAQNTAGGLLGGGPG 256
            ....:..:..|.|.|:.    ||.:..| :.|....|.....:.....|..|..|          
  Fly   537 PESTKAPVPAEDDEEDEDQAMLVDSEEAEDKPEDSHHDDDEDEDEDREAVNATTT---------- 591

  Fly   257 GGNVNGVGMVNGPRTPGDHNNNNNGPQTPTGGGSPFAAAAAAAAAAAHMKNQLGA--SSXNKALG 319
              :.|.:.:.....:|.|.|..:  |.:....    |||||||||.|:..|:..|  ....||| 
  Fly   592 --DSNELKIKKEQHSPLDLNVLS--PNSAIAA----AAAAAAAAACANDPNKFQALLIERTKAL- 647

  Fly   320 MGAAGAVVPGSGVGAGVGVGVGAASQQFYSGFGLQHQHQH-QQHHQQQQQQQQ 371
              ||.|:  .:|....:........||.:     |.|||| |||||||...||
  Fly   648 --AAEAL--KNGASDALSEDAHHQQQQHH-----QQQHQHQQQHHQQQHLHQQ 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 9/53 (17%)
LIM2_dLMO 156..210 CDD:188776 11/67 (16%)
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.