DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and pdlim5a

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_017211548.1 Gene:pdlim5a / 436927 ZFINID:ZDB-GENE-040718-401 Length:557 Species:Danio rerio


Alignment Length:116 Identity:34/116 - (29%)
Similarity:49/116 - (42%) Gaps:6/116 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156
            |:.|...|... ::.||...||..|..|..|...:.  ..|.:.:.....|:||:..||| || |
Zfish   440 CSRCHHKILGE-VINALKQTWHVYCFLCASCQQPIR--NDTFHLEDGEPYCERDFYSLFG-TG-C 499

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCE 207
            ..|...|.|.:..:.|....:|..||.|..|:... .|..|:..:.|.||:
Zfish   500 RGCDFPIEAGDKFLEALGGTWHDTCFVCTVCSVSL-EGQTFFSKKGKPLCK 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 13/53 (25%)
LIM2_dLMO 156..210 CDD:188776 15/52 (29%)
pdlim5aXP_017211548.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.