DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and LHX8

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_016856805.1 Gene:LHX8 / 431707 HGNCID:28838 Length:363 Species:Homo sapiens


Alignment Length:208 Identity:67/208 - (32%)
Similarity:98/208 - (47%) Gaps:22/208 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SGGQNNGPNPNGNGNVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNNNNN---GSQLCAGCGKH 98
            :|....|....|      :|:..|||..::.:.:.....:::..:..:.:.   |..:|..||..
Human    13 AGRTRKGAGEEG------LVSPEGAGDEDSCSSSAPLSPSSSPRSMASGSGCPPGKCVCNSCGLE 71

  Fly    99 IQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVI 163
            |.|:|||:..|:.||..||.|..|...||. .::.|.|...:.||.||.|.:|..  |:.|.:.|
Human    72 IVDKYLLKVNDLCWHVRCLSCSVCRTSLGR-HTSCYIKDKDIFCKLDYFRRYGTR--CSRCGRHI 133

  Fly   164 PAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMANHPMLKRH 228
            .:.:.|.||:.|||||.||||..|..:...|:.|.|.|.|:||...|:..|        ..|||.
Human   134 HSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCRVHYDCML--------DNLKRE 190

  Fly   229 VSSLGQG-SPTGA 240
            |.: |.| |..||
Human   191 VEN-GNGISVEGA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 21/53 (40%)
LIM2_dLMO 156..210 CDD:188776 23/53 (43%)
LHX8XP_016856805.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.