Sequence 1: | NP_001259687.1 | Gene: | Bx / 32846 | FlyBaseID: | FBgn0265598 | Length: | 424 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016856805.1 | Gene: | LHX8 / 431707 | HGNCID: | 28838 | Length: | 363 | Species: | Homo sapiens |
Alignment Length: | 208 | Identity: | 67/208 - (32%) |
---|---|---|---|
Similarity: | 98/208 - (47%) | Gaps: | 22/208 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 SGGQNNGPNPNGNGNVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNNNNN---GSQLCAGCGKH 98
Fly 99 IQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVI 163
Fly 164 PAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMANHPMLKRH 228
Fly 229 VSSLGQG-SPTGA 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bx | NP_001259687.1 | LIM1_LMO1_LMO3 | 92..146 | CDD:188774 | 21/53 (40%) |
LIM2_dLMO | 156..210 | CDD:188776 | 23/53 (43%) | ||
LHX8 | XP_016856805.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |