DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and stck

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster


Alignment Length:141 Identity:40/141 - (28%)
Similarity:65/141 - (46%) Gaps:13/141 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 AANNNNN------NNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYT 135
            |||:.|.      ::..|..:|..|.:.|::| ::.||...||.:...|..|:...  :|...|.
  Fly   193 AANDMNELYCLRCHDKMGIPICGACRRPIEER-VVTALGKHWHVEHFVCAKCEKPF--LGHRHYE 254

  Fly   136 KGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLC 200
            |..|..|:..|.:||||  .|..|::||..  .|..|....:.:..|||..|:.:.....:||..
  Fly   255 KRGLAYCETHYHQLFGN--LCFVCNQVIGG--DVFTALNKAWCVHHFACSVCDTKMTQKSKFYEY 315

  Fly   201 ENKILCEYDYE 211
            :.|.:|:..|:
  Fly   316 DEKPVCKKCYD 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 15/53 (28%)
LIM2_dLMO 156..210 CDD:188776 14/53 (26%)
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718
LIM3_PINCH 146..206 CDD:188719 4/12 (33%)
LIM4_PINCH 212..265 CDD:188720 15/55 (27%)
LIM5_PINCH 273..326 CDD:188721 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.