DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and LMX1A

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001167540.1 Gene:LMX1A / 4009 HGNCID:6653 Length:382 Species:Homo sapiens


Alignment Length:301 Identity:80/301 - (26%)
Similarity:118/301 - (39%) Gaps:56/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGY 155
            :|.||.:.|.||:|||..|..|||.|::|..|.   ..:.:|.:.:...:.||.||.:||...  
Human    34 VCEGCQRVILDRFLLRLNDSFWHEQCVQCASCK---EPLETTCFYRDKKLYCKYDYEKLFAVK-- 93

  Fly   156 CAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMA 220
            |..|.:.|...|.||||:.:||||.||.|..|..:...||.|.|.|.::||:.|||:.....|:.
Human    94 CGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLV 158

  Fly   221 NHPMLKRHVSSLGQGSPTGA-AGAQNTAGGLLGGGPGGGNVNGVGMVNGPRTPGDHNNNNNGPQT 284
                           ||..: :|..:....|.....|.|        .|....|..:.....|:|
Human   159 ---------------SPAASDSGKSDDEESLCKSAHGAG--------KGTAEEGKDHKRPKRPRT 200

  Fly   285 --PTGGGSPFAAA-AAAAAAAAHMKNQLGASSXNKALGMGAAGAVVPGSGVGAGVGVGVGAASQQ 346
              .|.....|.|: ..::.....::..|.|.:                     |:.|.|   .|.
Human   201 ILTTQQRRAFKASFEVSSKPCRKVRETLAAET---------------------GLSVRV---VQV 241

  Fly   347 FYSGFGLQHQHQHQQHHQQQQQQQQLMGLGLGMGGGGGVGG 387
            ::.....:.:...::..||||.||....|......|||..|
Human   242 WFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 19/53 (36%)
LIM2_dLMO 156..210 CDD:188776 23/53 (43%)
LMX1ANP_001167540.1 LIM1_Lmx1a 35..86 CDD:188756 19/53 (36%)
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764 23/53 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208 9/54 (17%)
Homeobox 198..252 CDD:395001 11/77 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..285 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.