DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and LMO2

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_005565.2 Gene:LMO2 / 4005 HGNCID:6642 Length:227 Species:Homo sapiens


Alignment Length:192 Identity:80/192 - (41%)
Similarity:93/192 - (48%) Gaps:38/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SGGAGGGNNGNGNVQSIAAAANNNNNNNNNGSQ-------------------------------- 90
            |||.|||..|....:.:.|.|............                                
Human    28 SGGDGGGGGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEEPVDEVLQI 92

  Fly    91 -----LCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF 150
                 .|.||.::|.|||.|:|:|..||||||.|..|.|||||||..||.|....||:|||||||
Human    93 PPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLF 157

  Fly   151 GNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYD-YE 211
            |..|.||:|.|.|.|:||.||.:..|||||||.|..|...||||||:.|..:.|:||.| ||
Human   158 GQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 31/53 (58%)
LIM2_dLMO 156..210 CDD:188776 30/54 (56%)
LMO2NP_005565.2 LIM1_LMO2 99..154 CDD:188770 32/54 (59%)
LIM2_LMO2 163..218 CDD:188771 30/54 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45787
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.