DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and LIMK1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_002305.1 Gene:LIMK1 / 3984 HGNCID:6613 Length:647 Species:Homo sapiens


Alignment Length:305 Identity:82/305 - (26%)
Similarity:120/305 - (39%) Gaps:72/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GSQL--CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF 150
            ||:|  ||.||:.|.|...|:||:..||.||.:  ||||. ..:....|.|...:.||:||...:
Human    19 GSELPVCASCGQRIYDGQYLQALNADWHADCFR--CCDCS-ASLSHQYYEKDGQLFCKKDYWARY 80

  Fly   151 GNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCE-NKILCEYDYE--- 211
            |.:  |..||:.|.. .:||.|....||.|||.|..|......||.:.|.| :|:.|.:.|.   
Human    81 GES--CHGCSEQITK-GLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTV 142

  Fly   212 -----ERLVFASMANH-----PMLKRHVSSLGQ----------GSPTGAAGAQNTAGGLLGGGPG 256
                 |:::..|..:|     .::....||.|:          ..|.|.....:....:.|..||
Human   143 VTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPG 207

  Fly   257 ------------GG---NVNGVGMVNGP--------------------RTPGDHNNNNNGPQT-P 285
                        |.   .:||..:.|.|                    ..|.|...:..||:| |
Human   208 CMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSP 272

  Fly   286 TGGGSPFAAAAAAAAAAAHMKNQLGASSXNKALGMGAAGAVVPGS 330
            .  .||....:..|.::|..|..|.:.|.:::.|.|:.|:  |.|
Human   273 L--SSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGS--PAS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 21/53 (40%)
LIM2_dLMO 156..210 CDD:188776 20/54 (37%)
LIMK1NP_002305.1 LIM1_LIMK1 5..77 CDD:188846 25/60 (42%)
LIM 84..138 CDD:295319 20/54 (37%)
PDZ 165..255 CDD:278991 13/89 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..319 17/58 (29%)
STKc_LIMK1 345..611 CDD:271123
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.