DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and ldb3

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_017950805.1 Gene:ldb3 / 394699 XenbaseID:XB-GENE-922381 Length:818 Species:Xenopus tropicalis


Alignment Length:121 Identity:39/121 - (32%)
Similarity:55/121 - (45%) Gaps:10/121 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGY 155
            |||.|...|:..:|: |:...||.:...|..|...|.:|......||  :.|:|.|.:.|..|  
 Frog   641 LCASCNSIIRGPFLV-AMGRSWHPEEFNCAHCKTSLADVSFVEEQKG--VYCERCYEQFFAPT-- 700

  Fly   156 CAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDR-FYLCENKILCEYDY 210
            ||.|:..|  ...||.|....:|..||.|..|...|  |:. |::.:.:..||.||
 Frog   701 CARCNTKI--MGEVMHALRQTWHTTCFVCAACRKPF--GNSLFHMEDGEPYCEKDY 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 16/53 (30%)
LIM2_dLMO 156..210 CDD:188776 17/54 (31%)
ldb3XP_017950805.1 PDZ_signaling 8..81 CDD:238492
DUF4749 209..310 CDD:406377
gliding_GltJ <462..>640 CDD:411345
LIM1_ZASP_Cypher 642..693 CDD:188838 16/53 (30%)
LIM2_Enigma_like 701..752 CDD:188748 17/54 (31%)
LIM3_Enigma_like 760..813 CDD:188749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.