DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and pdlim7

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_957134.1 Gene:pdlim7 / 393813 ZFINID:ZDB-GENE-040426-2092 Length:419 Species:Danio rerio


Alignment Length:145 Identity:48/145 - (33%)
Similarity:74/145 - (51%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NVQSIAAAANNNNNNNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDC-RLGEVGSTL 133
            |..||..||..:..:::..:.|||.|.|.|:.||:: ||...||.:  :..||.| ||.:.|...
Zfish   222 NRSSILQAAQQSPAHSSTATPLCAACSKIIRGRYVV-ALGRSWHPE--EFMCCQCKRLLDEGGFF 283

  Fly   134 YTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDR-F 197
            ..||:: .|.:.|...:...  ||.|.|:|..  .:|.|....||::||.|..|  :..:.:: |
Zfish   284 EEKGSI-YCSKCYDNRYSPN--CAKCKKIITG--EIMHALKMTYHVQCFLCAAC--KLPIRNQAF 341

  Fly   198 YLCENKILCEYDYEE 212
            |:.|.:..||.|||:
Zfish   342 YMEEGEPYCERDYEK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 20/54 (37%)
LIM2_dLMO 156..210 CDD:188776 18/54 (33%)
pdlim7NP_957134.1 PDZ_signaling 3..81 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..232 5/9 (56%)
LIM1_Enigma 244..295 CDD:188836 20/54 (37%)
LIM2_Enigma 303..354 CDD:188840 18/54 (33%)
LIM3_Enigma 362..416 CDD:188842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.