Sequence 1: | NP_001259687.1 | Gene: | Bx / 32846 | FlyBaseID: | FBgn0265598 | Length: | 424 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956490.1 | Gene: | pdlim5b / 393165 | ZFINID: | ZDB-GENE-040426-908 | Length: | 628 | Species: | Danio rerio |
Alignment Length: | 311 | Identity: | 60/311 - (19%) |
---|---|---|---|
Similarity: | 101/311 - (32%) | Gaps: | 116/311 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 QQQQSQQSNAGMNSGGQNNGPNPNGNGNVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNNNNNG 88
Fly 89 S-----------------------------------------------------------QLCAG 94
Fly 95 CGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNL--MLCKRDYLRLFGNTGYCA 157
Fly 158 ACSKVIPAFEMVMRARTNVYHLECFACQQC-----NHRFCVGDRFYLCENKIL---------CEY 208
Fly 209 DYE---------------------------ERLVFASMANHPMLKRHVSSL 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bx | NP_001259687.1 | LIM1_LMO1_LMO3 | 92..146 | CDD:188774 | 17/55 (31%) |
LIM2_dLMO | 156..210 | CDD:188776 | 18/67 (27%) | ||
pdlim5b | NP_956490.1 | PDZ_signaling | 11..80 | CDD:238492 | |
DUF4749 | 243..335 | CDD:292558 | 1/4 (25%) | ||
LIM1_Enigma_like | 452..503 | CDD:188747 | 16/52 (31%) | ||
LIM2_Enigma_like | 511..562 | CDD:188748 | 17/52 (33%) | ||
LIM | 570..624 | CDD:295319 | 8/53 (15%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |