DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Lhx4

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001101818.2 Gene:Lhx4 / 360858 RGDID:1308044 Length:390 Species:Rattus norvegicus


Alignment Length:121 Identity:50/121 - (41%)
Similarity:74/121 - (61%) Gaps:6/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156
            ||||.:||.|:::|:.||..||..||||..|..:|.:   ..:::...:.||.|:.:.||..  |
  Rat    30 CAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLAD---RCFSRAGSVYCKEDFFKRFGTK--C 89

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCEN-KILCEYDYE 211
            .||.:.||..::|.:|:..||||.||||..||.:...||.|||.|: :::|:.|||
  Rat    90 TACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 20/53 (38%)
LIM2_dLMO 156..210 CDD:188776 24/54 (44%)
Lhx4NP_001101818.2 LIM1_Lhx4 30..81 CDD:188852 20/53 (38%)
LIM2_Lhx3_Lhx4 89..144 CDD:188762 24/54 (44%)
Homeobox 160..214 CDD:395001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.