DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Pax

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster


Alignment Length:298 Identity:69/298 - (23%)
Similarity:106/298 - (35%) Gaps:83/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MTMDITKTE-----PGLVGLSSNQ----------------QQQQQQQSQQSNAGMN--------- 36
            :|:..||||     .|.||....|                ||..|..:.|:...::         
  Fly   200 ITVRETKTEKLTGPDGPVGTVEEQIVQQKDSYTPNHAVPGQQVHQAYTSQATKELDDLMASLSDF 264

  Fly    37 --SGGQN---NGPNPNGNGNVVNVVNSGGAGGGNNGN---------------------------G 69
              |.|.|   ||.:|..:.:.|...........|.|:                           |
  Fly   265 KVSNGTNGIGNGSHPQQHSSTVQHQTVTDYARPNKGSQQAHLTQTIEETTIVEDSREDQLDSMLG 329

  Fly    70 NVQSIAAAANNNNNNNNNGSQ-LCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTL 133
            |:|     ||.:....|...: .|..|.|.|..: ::.||...||.:...|..|...||.  ...
  Fly   330 NLQ-----ANMSRQGVNTVQKGCCNACEKPIVGQ-VITALGKTWHPEHFTCNHCSQELGT--RNF 386

  Fly   134 YTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDR-F 197
            :.:.....|:.||..||  :..||.|:..|  .:..:.|....:|.|.|.|.||..:|  |:. |
  Fly   387 FERDGFPYCEPDYHNLF--SPRCAYCNGAI--LDKCVTALDKTWHTEHFFCAQCGQQF--GEEGF 445

  Fly   198 YLCENKILCEYDYEERLVFA---SMANHPMLKRHVSSL 232
            :..:.|..|..||.|  :||   :..|..:::.::|:|
  Fly   446 HERDGKPYCRNDYFE--MFAPKCNGCNRAIMENYISAL 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 13/53 (25%)
LIM2_dLMO 156..210 CDD:188776 16/54 (30%)
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 14/54 (26%)
LIM2_Paxillin_like 407..458 CDD:188723 16/54 (30%)
LIM3_Paxillin_like 466..518 CDD:188724 3/16 (19%)
LIM4_Paxillin 525..576 CDD:188795
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.