DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and CG5708

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster


Alignment Length:217 Identity:75/217 - (34%)
Similarity:104/217 - (47%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNNNNNGSQL---------CAGCGKHIQDRYLLRA 107
            |::..||.........|.|:.|...:..:.::|:.|..||         |.|||..|.|||||.|
  Fly    29 VIDYRNSNHTKDTVETNSNISSSQLSFMDESSNDFNNQQLIHSNSLIKVCGGCGDKISDRYLLYA 93

  Fly   108 LDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRA 172
            ||..||..||||.||...|.||||:.:|:..|:|||:||..:||.:|.|:.|.:.||..|:|.:|
  Fly    94 LDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPSELVAKA 158

  Fly   173 RTN----------------VYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMAN 221
            .|.                |:||.||:|.:|......|||:.:....::||.|:           
  Fly   159 LTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGASLVCEQDW----------- 212

  Fly   222 HPMLKRHVSSLGQ-GSPTGAAG 242
            |.:||...:|.|. |...|..|
  Fly   213 HKLLKGPANSNGTLGQRKGKVG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 31/53 (58%)
LIM2_dLMO 156..210 CDD:188776 20/69 (29%)
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 31/53 (58%)
LIM 142..212 CDD:413332 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2809
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45787
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.