DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Lhx2

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006234134.1 Gene:Lhx2 / 296706 RGDID:71076 Length:414 Species:Rattus norvegicus


Alignment Length:300 Identity:93/300 - (31%)
Similarity:128/300 - (42%) Gaps:50/300 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NGPNPNGNGNVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNN------NNNGSQLCAGCGKHIQ 100
            :||..:|   |::.::       ........:|::|.:..:..      :::.:.||||||..|.
  Rat     7 SGPEVHG---VIDEMD-------RRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKIS 61

  Fly   101 DRYLLRALDMLWHEDCLKCGCCDCRLG-EVGSTLYTKGNLMLCKRDYL--------RLFGNTGYC 156
            |||.|.|:|..||..|||  ||:|:|. |...|.::|...:.||.||.        |.| :...|
  Rat    62 DRYYLLAVDKQWHMRCLK--CCECKLNLESELTCFSKDGSIYCKEDYYSPSLHGPHRRF-SVQRC 123

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMAN 221
            |.|...|.|.|||||||..||||.||.|..||.....||.|.:.::.:.|...:|..|    ...
  Rat   124 ARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALL----QGE 184

  Fly   222 HPMLKRHVSSLGQGSPTGAAGAQNTAG-GLLGGGP-GGGNVNGVGMVNGPRTPGDHNNNNNGPQT 284
            :|   .|.:.....:...||.|..:|| |..|..| |....||||.|...|   .....:.||  
  Rat   185 YP---AHFNHADVAAAAAAAAAAKSAGLGSAGANPLGLPYYNGVGTVQKGR---PRKRKSPGP-- 241

  Fly   285 PTGGGSPFAAAAAAAAA----AAHMKNQLGASSXNKALGM 320
                |:..||..||.:.    |.|:.......|..|...|
  Rat   242 ----GADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 26/54 (48%)
LIM2_dLMO 156..210 CDD:188776 25/53 (47%)
Lhx2XP_006234134.1 LIM1_Lhx2 43..106 CDD:188853 27/64 (42%)
LIM2_Lhx2_Lhx9 119..177 CDD:188763 25/57 (44%)
COG5576 <255..386 CDD:227863 4/22 (18%)
Homeobox 278..331 CDD:395001 92/299 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.