DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Lpxn

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_038964643.1 Gene:Lpxn / 293783 RGDID:1304981 Length:398 Species:Rattus norvegicus


Alignment Length:148 Identity:43/148 - (29%)
Similarity:65/148 - (43%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEV--GSTLYTKGNLMLCKRDYLRLFG 151
            |..||.|...|.|: :|.|::..||.:...|..|    |||  ....:.|.....|::|:|.:| 
  Rat   220 SPRCAYCAAPITDK-VLTAMNKTWHPEHFFCSHC----GEVFGAEGFHEKDKKPYCRKDFLAMF- 278

  Fly   152 NTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERL-V 215
             :..|..|::  |..|..:.|...|:|.|||.|..|...|..|. |:..:.:..||..|..|. .
  Rat   279 -SPKCGGCNR--PVLENYLSAMNTVWHPECFVCGDCFSSFSSGS-FFELDGRPFCELHYHHRRGT 339

  Fly   216 FASMANHPMLKRHVSSLG 233
            .......|:..|.:|::|
  Rat   340 LCHDCGQPITGRCISAMG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 16/55 (29%)
LIM2_dLMO 156..210 CDD:188776 17/53 (32%)
LpxnXP_038964643.1 LIM1_Leupaxin 162..216 CDD:188790
LIM 223..274 CDD:413332 16/55 (29%)
LIM 282..334 CDD:413332 17/54 (31%)
LIM4_Paxillin_like 341..392 CDD:188725 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.