DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Lmo1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_038954443.1 Gene:Lmo1 / 245979 RGDID:621166 Length:199 Species:Rattus norvegicus


Alignment Length:92 Identity:56/92 - (60%)
Similarity:63/92 - (68%) Gaps:17/92 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 CCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQ 185
            ||             .|:.:|.|    ||||.||.||||||:|||||||||||.|||||:|||||
  Rat   113 CC-------------PGSFILRK----RLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQ 160

  Fly   186 QCNHRFCVGDRFYLCENKILCEYDYEE 212
            .||.||||||:|:|..|.|||:.||||
  Rat   161 LCNQRFCVGDKFFLKNNMILCQMDYEE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 5/24 (21%)
LIM2_dLMO 156..210 CDD:188776 41/53 (77%)
Lmo1XP_038954443.1 LIM2_LMO1_LMO3 131..185 CDD:188775 41/53 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I5977
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 1 1.000 - - otm45830
orthoMCL 1 0.900 - - OOG6_105630
Panther 1 1.100 - - LDO PTHR45787
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1872
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.