DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and ABLIM3

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001287944.1 Gene:ABLIM3 / 22885 HGNCID:29132 Length:683 Species:Homo sapiens


Alignment Length:162 Identity:47/162 - (29%)
Similarity:66/162 - (40%) Gaps:20/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRL-GEVGSTLYTKGNLMLCKRDYLRLFG 151
            |...||||.:.|:....|.|||..||..|.||..|...| ||    ..:|..:..|:.||...||
Human   147 GPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGE----YISKDGVPYCESDYHAQFG 207

  Fly   152 NTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKI---LCEYDYEER 213
            ..  |..|.:.|..  .|:.|....||..|..|.:|:..|..|:..||..:::   :|:.     
Human   208 IK--CETCDRYISG--RVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQ----- 263

  Fly   214 LVFASMANHPMLKRHVSSLGQGSPTGAAGAQN 245
               |:.|...:..|..|......|..:.|:.|
Human   264 ---AARAEKKLKHRRTSETSISPPGSSIGSPN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 20/54 (37%)
LIM2_dLMO 156..210 CDD:188776 15/56 (27%)
ABLIM3NP_001287944.1 LIM1_abLIM 23..74 CDD:188713
LIM2_abLIM 79..134 CDD:188714
LIM3_abLIM 151..202 CDD:188715 20/54 (37%)
LIM4_abLIM 210..265 CDD:188716 15/64 (23%)
AbLIM_anchor 274..647 CDD:292800 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..472
VHP 648..683 CDD:128458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.