| Sequence 1: | NP_001259687.1 | Gene: | Bx / 32846 | FlyBaseID: | FBgn0265598 | Length: | 424 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_848803.3 | Gene: | Ablim1 / 226251 | MGIID: | 1194500 | Length: | 861 | Species: | Mus musculus |
| Alignment Length: | 222 | Identity: | 58/222 - (26%) |
|---|---|---|---|
| Similarity: | 87/222 - (39%) | Gaps: | 39/222 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 66 NGNGNVQSIAAAANNNNNNNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVG 130
Fly 131 STLY-TKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVG 194
Fly 195 DRFYL---------CENKILCE--------------YDYEERLV-------FASMANHPMLKRHV 229
Fly 230 SSLGQGSPTGAAGAQNTAGGLLGGGPG 256 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Bx | NP_001259687.1 | LIM1_LMO1_LMO3 | 92..146 | CDD:188774 | 21/54 (39%) |
| LIM2_dLMO | 156..210 | CDD:188776 | 18/76 (24%) | ||
| Ablim1 | NP_848803.3 | LIM1_abLIM | 99..150 | CDD:188713 | |
| LIM2_abLIM | 155..210 | CDD:188714 | 2/9 (22%) | ||
| LIM3_abLIM | 226..277 | CDD:188715 | 21/54 (39%) | ||
| LIM4_abLIM | 285..340 | CDD:188716 | 17/56 (30%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 374..414 | 8/40 (20%) | |||
| AbLIM_anchor | 394..825 | CDD:292800 | 5/20 (25%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 459..590 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 634..682 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 713..748 | ||||
| VHP | 826..861 | CDD:128458 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||