DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Bx and unc-97

DIOPT Version :9

Sequence 1:	NP_001259687.1	Gene:	Bx / 32846	FlyBaseID:	FBgn0265598	Length:	424	Species:	Drosophila melanogaster
Sequence 2:	NP_508943.3	Gene:	unc-97 / 180827	WormBaseID:	WBGene00006826	Length:	348	Species:	Caenorhabditis elegans

Alignment Length:	124	Identity:	33/124 - (26%)
Similarity:	58/124 - (46%)	Gaps:	7/124 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    88 GSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGN 152
            |..:|..|.:.|::| ::.||...||.:...|..|:...  :|...|.:..|..|::.:.:||||
Worm   201 GIPICGACHRPIEER-VIAALGKHWHVEHFVCSVCEKPF--LGHRHYERKGLPYCEQHFHKLFGN 262

  Fly   153 TGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYE 211
              .|..|..  |....|.:|....:.::||:|..|:.:.....:||..:.|..|:..|:
Worm   263 --LCFKCGD--PCCGEVFQALQKTWCVKCFSCSFCDKKLDQKTKFYEFDMKPTCKRCYD 317

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Bx	NP_001259687.1	LIM1_LMO1_LMO3	92..146	CDD:188774	14/53 (26%)
Bx	NP_001259687.1	LIM2_dLMO	156..210	CDD:188776	13/53 (25%)
unc-97	NP_508943.3	LIM1_PINCH	21..79	CDD:188717
		LIM2_PINCH	82..133	CDD:188718
		LIM3_PINCH	146..197	CDD:188719
		LIM4_PINCH	203..256	CDD:188720	14/55 (25%)
		LIM5_PINCH	264..317	CDD:188721	13/54 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1593918at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010