DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and pin-2

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001255672.1 Gene:pin-2 / 178234 WormBaseID:WBGene00004030 Length:330 Species:Caenorhabditis elegans


Alignment Length:138 Identity:37/138 - (26%)
Similarity:57/138 - (41%) Gaps:17/138 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 AAANNNNNNNNNGSQLCAGCGK--HIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGN 138
            ||......|:....:.|..|.:  .:.:.|.|..... ||..|..|..|...|  ||:|.:...|
 Worm     5 AAQITKQRNSGKRHRACERCREQFELNEPYFLLGASS-WHMRCFLCAQCMDPL--VGTTYFQFEN 66

  Fly   139 LMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCN--------HRFCVGD 195
            .:.|:.|:..|:...  ||.|::.:  ...|:.:..|.|||.||.|.:||        :|:....
 Worm    67 RIYCEHDFKTLYAPV--CAKCNEFV--IGQVVHSSNNSYHLACFTCDECNVHLNSQIAYRYQGTI 127

  Fly   196 RFYLCENK 203
            ..:||..|
 Worm   128 LCFLCNQK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 15/55 (27%)
LIM2_dLMO 156..210 CDD:188776 17/56 (30%)
pin-2NP_001255672.1 LIM1_PINCH 21..79 CDD:188717 17/60 (28%)
LIM 82..133 CDD:295319 15/52 (29%)
LIM 144..195 CDD:295319
LIM4_PINCH 200..256 CDD:188720
LIM 264..315 CDD:295319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.