DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and alp-1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001023371.1 Gene:alp-1 / 177701 WormBaseID:WBGene00001132 Length:1424 Species:Caenorhabditis elegans


Alignment Length:247 Identity:56/247 - (22%)
Similarity:85/247 - (34%) Gaps:50/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MDITKTEPGLVGLSSNQQQQQ--------QQQSQQSNAGMNSGGQNNGPNPNGNGNVVNVVNSGG 60
            :|..|...|..|.|.:..||.        ::.:.::....|:|....| :..|.|::.....:..
 Worm  1180 IDENKKAGGSNGSSQHHNQQGSSYTKTSFERTTTETRPQQNTGAPRAG-DFRGTGHLTTTTTTQQ 1243

  Fly    61 AGGG-----------------NNGNGNVQSIAAAANNNNNN--------NNNGSQLCAGC-GKHI 99
            .||.                 ..|..........||::...        ..:|.:.|..| .:||
 Worm  1244 NGGRAPFCESCKQQIRGAFVLATGKSWCPEHFVCANSSCRRRLLECGFVEEDGQKFCESCFEQHI 1308

  Fly   100 QDRY----------LLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTG 154
            ..|.          .|.||...||..|..|..|....|  .|..|.:..|..|::|:..||  |.
 Worm  1309 APRCNKCSKPIISDCLNALQKKWHPTCFTCAHCQKPFG--NSAFYLEQGLPYCEQDWNALF--TT 1369

  Fly   155 YCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILC 206
            .|.:|...|.|.:..:.|..|.:|..||.|.:|||.. .|:.|:....:..|
 Worm  1370 KCVSCRYPIEAGDRWVEALGNAFHSNCFTCARCNHNL-EGESFFAKNGQPFC 1420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 18/64 (28%)
LIM2_dLMO 156..210 CDD:188776 16/51 (31%)
alp-1NP_001023371.1 PDZ_signaling 5..80 CDD:238492
DUF4749 137..>197 CDD:292558
ZM 137..162 CDD:128974
LIM_ALP_like 220..271 CDD:188746
LIM1_Enigma_like_1 1251..1304 CDD:188839 5/52 (10%)
LIM 1312..1363 CDD:295319 13/52 (25%)
LIM3_Enigma_like_1 1371..1424 CDD:188845 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.