DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and pxl-1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001021185.2 Gene:pxl-1 / 175831 WormBaseID:WBGene00016197 Length:413 Species:Caenorhabditis elegans


Alignment Length:232 Identity:53/232 - (22%)
Similarity:97/232 - (41%) Gaps:33/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITKTEPGLVGLSSNQQQQQQQQSQQSNAGMNSGGQNNGPNPNGNGNVVNVVNSGGAGGGNNGNGN 70
            :::.|...:..||:::........||.:.:.|.|::...:|..:.:::..:           ||.
 Worm   108 LSQVEEPPIRASSSRKSLGPPSQAQSYSDVRSNGRSPSRDPLHSDSMIGTM-----------NGE 161

  Fly    71 VQSIAAAANNNNNNNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYT 135
            :.|     .:..|....|.  ||.|||.|..:.:: ||..:||.:...|..|...||:  ...:.
 Worm   162 LSS-----KHGVNTIPKGD--CAACGKPIIGQVVI-ALGKMWHPEHYTCCECGAELGQ--RPFFE 216

  Fly   136 KGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVG-DRFYL 199
            :.....|:.||...|  :..|..|.:.|.  :..:......:|:|||.|.:||..|  | |.|:.
 Worm   217 RNGRAFCEEDYHNQF--SPKCQGCHRAIT--DRCVSVMNKNFHIECFTCAECNQPF--GEDGFHE 275

  Fly   200 CENKILCEYDYEERLVFASMAN---HPMLKRHVSSLG 233
            ...:..|:.|:..  :||...|   .|:....:::||
 Worm   276 KNGQTYCKRDFFR--LFAPKCNGCSQPITSNFITALG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 15/53 (28%)
LIM2_dLMO 156..210 CDD:188776 15/54 (28%)
pxl-1NP_001021185.2 LIM1_Leupaxin 174..228 CDD:188790 17/58 (29%)
LIM 235..290 CDD:278823 16/60 (27%)
LIM3_Paxillin_like 294..346 CDD:188724 4/17 (24%)
LIM4_Paxillin_like 353..404 CDD:188725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.