DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lin-11

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_492696.1 Gene:lin-11 / 172893 WormBaseID:WBGene00003000 Length:405 Species:Caenorhabditis elegans


Alignment Length:236 Identity:68/236 - (28%)
Similarity:109/236 - (46%) Gaps:39/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156
            ||.|.:.|.|||:...|...||:.||:  ||||| ..:..|.:::..|:|||.|:.|.:...  |
 Worm    68 CAACAQPILDRYVFTVLGKCWHQSCLR--CCDCR-APMSMTCFSRDGLILCKTDFSRRYSQR--C 127

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCE-NKILCEYDYEERLVFASMA 220
            |.|...:...::|.|||..|:|:.||.|..|......||:.|:.| |:.:|:.|::.    |:..
 Worm   128 AGCDGKLEKEDLVRRARDKVFHIRCFQCSVCQRLLDTGDQLYIMEGNRFVCQSDFQT----ATKT 188

  Fly   221 NHP-MLKRHVSSLGQGSPTGAAGAQNTAGGLLGGGPGGGNVNG---VGMVNGPRTPGDHNNNNN- 280
            :.| .:.|.||:   ||...:...::             ||:.   ||:.:|....|..|:::: 
 Worm   189 STPTSIHRPVSN---GSECNSDVEED-------------NVDACDEVGLDDGEGDCGKDNSDDSN 237

  Fly   281 -----GPQTPTGGGSPFA---AAAAAAAAAAHMKNQLGASS 313
                 ||:|.........   |.||......|::.||.|.:
 Worm   238 SAKRRGPRTTIKAKQLETLKNAFAATPKPTRHIREQLAAET 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 22/53 (42%)
LIM2_dLMO 156..210 CDD:188776 19/54 (35%)
lin-11NP_492696.1 LIM 68..123 CDD:278823 24/57 (42%)
LIM2_Lhx1_Lhx5 127..182 CDD:188761 19/54 (35%)
Homeobox 244..297 CDD:278475 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2809
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.