DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Lhx3

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_038962056.1 Gene:Lhx3 / 170671 RGDID:71078 Length:416 Species:Rattus norvegicus


Alignment Length:318 Identity:87/318 - (27%)
Similarity:125/318 - (39%) Gaps:74/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGY 155
            :||||.:||.||::|:|||..||..||||..|...|.|   ..:::|..:.||.|:.:.||..  
  Rat    20 MCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAE---RCFSRGESVYCKDDFFKRFGTK-- 79

  Fly   156 CAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCE-NKILCEYDYE-----ERL 214
            ||||...||..::|.||:..||||.||||..|..:...||.|||.| ::::|:.|||     |..
  Rat    80 CAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAE 144

  Fly   215 VFASMANHPMLKRHVSSLGQGSPTGAAGAQNTAGGLLGGGPGGGNVNGVGMVNGPRTPGDHNNNN 279
            ..|......:..:.:.:|.....|....|::....|  ....|.::..|.:....|.|..     
  Rat   145 ATAKRPRTTITAKQLETLKSAYNTSPKPARHVREQL--SSETGLDMRVVQVSARSRPPAP----- 202

  Fly   280 NGPQTPTGGGSPF----------------------AAAAAAAAAAAHMKNQLGASSXNK------ 316
            .|.:.|...|.|.                      |..........:||...|:|. :|      
  Rat   203 EGARAPREAGQPLTIPTPQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGSSKSDKDSIQEG 267

  Fly   317 --------------ALGMGAAGAVV-----PGSGVGAGVGVGVGAASQQFYSGFGLQH 355
                          ...||.|..:.     |...:|..|| |:|:        |.|:|
  Rat   268 QDSDAEVSFTDEPSMADMGTANGLYSSLGEPAPALGRPVG-GLGS--------FTLEH 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 24/53 (45%)
LIM2_dLMO 156..210 CDD:188776 25/54 (46%)
Lhx3XP_038962056.1 LIM1_Lhx3b 18..72 CDD:188851 24/54 (44%)
LIM2_Lhx3_Lhx4 80..135 CDD:188762 25/54 (46%)
Homeobox 150..233 CDD:395001 12/89 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.