DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and PRICKLE2

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_011531734.1 Gene:PRICKLE2 / 166336 HGNCID:20340 Length:966 Species:Homo sapiens


Alignment Length:179 Identity:43/179 - (24%)
Similarity:69/179 - (38%) Gaps:25/179 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NNGNGNVQSIAAAANNNNNNNNNGSQLCAGCGKHIQDR----YLLRA-LDMLWHEDCLKCGCCDC 124
            |.|.|||:.......         ..:|..||..|...    :..|| ..:.||..|..|..|:.
Human   204 NLGRGNVRPFPVTMT---------GAICEQCGGQINGGDIAVFASRAGHGVCWHPPCFVCTVCNE 259

  Fly   125 RLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNH 189
            .|.:: ...|..|.: .|.|.:....  ...||||.::|.|.|.. .|....:|::.|.|.:| .
Human   260 LLVDL-IYFYQDGKI-YCGRHHAECL--KPRCAACDEIIFADECT-EAEGRHWHMKHFCCFEC-E 318

  Fly   190 RFCVGDRFYLCENKILCEYDYEERLVFASMANHPMLKRHVSSLGQGSPT 238
            ....|.|:.:.|.:..|.:.:|.  ::|...:  ...:|: .:.||..|
Human   319 TVLGGQRYIMKEGRPYCCHCFES--LYAEYCD--TCAQHI-GIDQGQMT 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 16/58 (28%)
LIM2_dLMO 156..210 CDD:188776 16/53 (30%)
PRICKLE2XP_011531734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.