DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and AgaP_AGAP008979

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_319729.4 Gene:AgaP_AGAP008979 / 1279942 VectorBaseID:AGAP008979 Length:271 Species:Anopheles gambiae


Alignment Length:247 Identity:55/247 - (22%)
Similarity:91/247 - (36%) Gaps:63/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 CLKCGCCDC-RLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHL 179
            ||:  ||.| ...|...:.|::...:.||.||.|.| :...||.|...|.|.::||||:..::|:
Mosquito     3 CLR--CCKCLHTLEAELSCYSREGNIYCKDDY
YRHF-SVRRCARCGNGISASDLVMRAKDLIFHV 64

  Fly   180 ECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMANHPMLKRHVSSLGQGSPTGAAGAQ 244
            .||:|..|......||...:.:.::.|......|           .:|...:.|..:|.|    :
Mosquito    65 NCFSCLICGQLLRGGDTAGIRDGRVFCGKLPTNR-----------ARRQTPNRGGANPPG----R 114

  Fly   245 NTAGGLLGGGPG----------GGNVNGVGMVNGPR-----------------------TPGDHN 276
            .:..|||   ||          ..::.|..:.:.||                       ||.: :
Mosquito   115 QSTHGLL---PGQVCHLLWHFNHVSIPGAHIRSPPRWNYCAKDGSLHCDCRRRSRSNVSTPSE-D 175

  Fly   277 NNNNGPQTPTGGGSPFAAAAAAAAAAAHMKNQLGASSXNKALGMGAAGAVVP 328
            :.....|..||       ..:.:.......|.|..|: :.:...|:.||:.|
Mosquito   176 SKAKTTQVNTG-------CCSCSEVDVLSVNSLDLSTYDGSQSPGSGGALTP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 9/30 (30%)
LIM2_dLMO 156..210 CDD:188776 17/53 (32%)
AgaP_AGAP008979XP_319729.4 LIM <1..32 CDD:295319 9/30 (30%)
LIM 37..91 CDD:295319 16/53 (30%)
HOX 224..270 CDD:197696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.