DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and AgaP_AGAP007840

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_317659.3 Gene:AgaP_AGAP007840 / 1278120 VectorBaseID:AGAP007840 Length:111 Species:Anopheles gambiae


Alignment Length:101 Identity:30/101 - (29%)
Similarity:49/101 - (48%) Gaps:23/101 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LFGNTGYCAACSKVIPAFEMVMRART----------------------NVYHLECFACQQCNHRF 191
            ||| :|.|:||.:.|||.|.|||..:                      :|:||:||.|.:|....
Mosquito     1 LFG-SGACSACHQTIPANEFVMRTTSHTTINNNLNNAANNNNNQNGTHHVFHLKCFQCSKCGSHL 64

  Fly   192 CVGDRFYLCENKILCEYDYEERLVFASMANHPMLKR 227
            ..|||:|:....::||.|:.:.:...:...:|.|::
Mosquito    65 VQGDRYYMLGGSLVCEPDWHKLVKTTNSQTNPPLRK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774
LIM2_dLMO 156..210 CDD:188776 23/75 (31%)
AgaP_AGAP007840XP_317659.3 LIM 7..83 CDD:295319 23/75 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.