DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and AgaP_AGAP008532

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_316909.4 Gene:AgaP_AGAP008532 / 1277441 VectorBaseID:AGAP008532 Length:596 Species:Anopheles gambiae


Alignment Length:149 Identity:40/149 - (26%)
Similarity:66/149 - (44%) Gaps:9/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRL 149
            :|..|..||.|...|.|: .:.||:..||.:...|..|..:.||.|  .:.:.....|:.||..:
Mosquito   415 HNLFSPRCAYCNGPILDK-CVTALEKTWHTEHFFCAQCGQQFGEDG--FHERDGKPYCRNDYFDM 476

  Fly   150 FGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYE-ER 213
            |...  |..|::.|  .|..:.|..:.:|.:||.|:.|...| .|..|:..|....||..|. :|
Mosquito   477 FAPK--CNGCNRAI--MENYISALNSQWHPDCFVCRDCREPF-HGGSFFDHEGLPYCETHYHAKR 536

  Fly   214 LVFASMANHPMLKRHVSSL 232
            ....:..:.|:..|.::::
Mosquito   537 GSLCAGCSKPITGRCITAM 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 15/53 (28%)
LIM2_dLMO 156..210 CDD:188776 16/53 (30%)
AgaP_AGAP008532XP_316909.4 LIM1_Paxillin_like 363..415 CDD:259830 40/149 (27%)
LIM2_Paxillin_like 422..473 CDD:188723 15/53 (28%)
LIM3_Paxillin_like 481..533 CDD:188724 16/54 (30%)
LIM4_Paxillin 540..591 CDD:188795 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.