DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and AgaP_AGAP003429

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_003436478.1 Gene:AgaP_AGAP003429 / 1272802 VectorBaseID:AGAP003429 Length:347 Species:Anopheles gambiae


Alignment Length:167 Identity:42/167 - (25%)
Similarity:75/167 - (44%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 AANNNNN------NNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYT 135
            |||:.|.      ::..|..:|..|.:.|::| ::.||...||.:...|..|:...  :|...|.
Mosquito   191 AANDMNELYCLRCHDRMGIPICGACRRPIEER-VVTALGKHWHVEHFVCAKCEKPF--LGHRHYE 252

  Fly   136 KGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLC 200
            |..:..|:..|.:||||  .|..|::||..  .|..|....:.:..|:|..|:.:.....:|:..
Mosquito   253 KRGMAYCETHYHQLFGN--LCFVCNQVIAG--DVFTALNKAWCVHHFSCSICDQKLDQKSKFFEY 313

  Fly   201 ENKILCEYDYEERLVFASMANHPMLKRHVSSLGQGSP 237
            :.|.:|:..||.   |.|.....:...|.:::.:.:|
Mosquito   314 DEKPVCKKCYER---FPSELRRRLRISHENTIKKPAP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 14/53 (26%)
LIM2_dLMO 156..210 CDD:188776 12/53 (23%)
AgaP_AGAP003429XP_003436478.1 LIM1_PINCH 19..77 CDD:188717
LIM2_PINCH 80..131 CDD:188718
LIM3_PINCH 144..204 CDD:188719 4/12 (33%)
LIM4_PINCH 210..263 CDD:188720 14/55 (25%)
LIM5_PINCH 271..324 CDD:188721 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.