DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and AgaP_AGAP000755

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_311291.4 Gene:AgaP_AGAP000755 / 1272345 VectorBaseID:AGAP000755 Length:178 Species:Anopheles gambiae


Alignment Length:146 Identity:42/146 - (28%)
Similarity:68/146 - (46%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGY 155
            :|.||.:.|:|: :|.|||..||.:...|..|..|:.|  :..:....|.:|.:.:....  ...
Mosquito     4 VCFGCKEEIKDK-MLEALDKSWHPEHFACKECKKRIAE--NKFHESEGLPVCSKCFESKV--QAI 63

  Fly   156 CAACSKVIPAFEMVMRARTNVYHLECFAC-QQCNHRFCVGDRFYLCENKILCEYDYEERLVFASM 219
            ||||.|::.  |.|::|....:|||.|.| ..|..:.. |..|:....|..|..|||.  ::|..
Mosquito    64 CAACRKLVT--EKVVKAMGKTWHLEHFICGGPCKQQLS-GKTFFERNGKPYCTADYER--LYAPK 123

  Fly   220 ---ANHPMLKRHVSSL 232
               ...|:.::.:|:|
Mosquito   124 CGGCKKPIAEKALSAL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 17/53 (32%)
LIM2_dLMO 156..210 CDD:188776 18/54 (33%)
AgaP_AGAP000755XP_311291.4 LIM 5..56 CDD:295319 17/53 (32%)
LIM 64..116 CDD:295319 18/54 (33%)
LIM 124..176 CDD:295319 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.