DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and AgaP_AGAP009503

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_310193.4 Gene:AgaP_AGAP009503 / 1271408 VectorBaseID:AGAP009503 Length:499 Species:Anopheles gambiae


Alignment Length:260 Identity:60/260 - (23%)
Similarity:85/260 - (32%) Gaps:73/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TKTEPGLVGLSSNQQQQQQQQSQQSNAGMNSGGQNN--------GPNP----NGNGN---VVNVV 56
            |...||..||.:|   ....||.....||:|.|...        .|.|    :|..|   ....|
Mosquito   183 TMVGPGAGGLYAN---NMHHQSLYGTYGMSSQGSTTYESIYEPINPRPPSQMSGRSNYSLYAPYV 244

  Fly    57 NSGGAGGGNNGNGNVQSIAAAANNNNNNNNNGSQ------------------------LCAGCGK 97
            ||.|....|  :..:.|.:.......:.:|.||.                        .|..||:
Mosquito   245 NSHGINSPN--DSIITSASQQQQQQQHRHNQGSMSKGAEVDTLTDLLVQSIHDQESFGTCVKCGE 307

  Fly    98 H-IQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSK 161
            . :.::....|:|.::|..|..|.  .|::...|...|.......||.|||.....   |:.|.|
Mosquito   308 RVVGEKTGCTAMDKIYHIACFTCH--QCQINLQGKPFYGLDGKPYCKEDYLNTLEK---CSVCLK 367

  Fly   162 VIPAFEMVMRARTNVYHLECFACQQC--------------NHRFCVGD-------RFYLCENKIL 205
              |..|.::||....||.:||.|..|              |...|:.|       |..:|:..|:
Mosquito   368 --PILERILRATGKPYHPQCFTCIVCGKSLDGIPFTVDATNQIHCIDDFHKKFAPRCCVCKMPIM 430

  Fly   206  205
            Mosquito   431  430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 13/54 (24%)
LIM2_dLMO 156..210 CDD:188776 19/71 (27%)
AgaP_AGAP009503XP_310193.4 LIM1_LPP 302..355 CDD:188737 13/54 (24%)
LIM2_LPP 362..421 CDD:188740 16/60 (27%)
LIM3_LPP 422..489 CDD:188821 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.