DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and WTIP

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_011524754.1 Gene:WTIP / 126374 HGNCID:20964 Length:472 Species:Homo sapiens


Alignment Length:136 Identity:45/136 - (33%)
Similarity:62/136 - (45%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LCAGCGKHIQD-RYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTG 154
            :|..||..|.. :...:|:..|:|.||..|..|..||.  |...|..|..:.|:.|:|    .:|
Human   224 ICIKCGLGIYGAQQACQAMGSLYHTDCFTCDSCGRRLR--GKAFYNVGEKVYCQEDFL----YSG 282

  Fly   155 Y------CAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCV-GDRFYL-CENKILCEYDYE 211
            :      |:.|..:|  .||:::|....||..||.|..||.  |: |..|.: .||.|.|..|| 
Human   283 FQQTADKCSVCGHLI--MEMILQALGKSYHPGCFRCSVCNE--CLDGVPFTVDVENNIYCVRDY- 342

  Fly   212 ERLVFA 217
             ..|||
Human   343 -HTVFA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 17/54 (31%)
LIM2_dLMO 156..210 CDD:188776 20/55 (36%)
WTIPXP_011524754.1 LIM1_Ajuba_like 225..278 CDD:188738 17/54 (31%)
LIM2_Ajuba_like 290..342 CDD:188741 20/55 (36%)
LIM 350..404 CDD:295319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.