DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lmo3

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_031754259.1 Gene:lmo3 / 116409661 -ID:- Length:182 Species:Xenopus tropicalis


Alignment Length:124 Identity:96/124 - (77%)
Similarity:108/124 - (87%) Gaps:0/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156
            ||||.:.|:|||||:|||..||||||||.||||||||||||||||.||:||:||||||||.||.|
 Frog    50 CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNC 114

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLV 215
            |||||:||||||||||:.|||||:|||||.||.||||||:|:|..|.|||:.||||.|:
 Frog   115 AACSKLIPAFEMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLM 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 42/53 (79%)
LIM2_dLMO 156..210 CDD:188776 40/53 (75%)
lmo3XP_031754259.1 LIM1_LMO1_LMO3 50..104 CDD:188774 42/53 (79%)
LIM2_LMO1_LMO3 114..168 CDD:188775 40/53 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6074
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 1 1.000 - - otm48920
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1872
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.