DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Lmx1b

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_446161.1 Gene:Lmx1b / 114501 RGDID:620843 Length:402 Species:Rattus norvegicus


Alignment Length:296 Identity:85/296 - (28%)
Similarity:120/296 - (40%) Gaps:66/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGY 155
            :|.||.:.|.||:|:|..:..|||:||:|..|...|   .::.|.:...:.||:||.:||  ...
  Rat    55 VCEGCQRPISDRFLMRVNESSWHEECLQCAACQQAL---TTSCYFRDRKLYCKQDYQQLF--AAK 114

  Fly   156 CAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYE-ERLVFASM 219
            |:.|.:.|...|.||||...||||.||.|..|..:...||.|.|.|.::||:.||| |:.:.:|:
  Rat   115 CSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSV 179

  Fly   220 ANHPMLKRHVSSL---GQGSPTGAAGAQNTAGGLLGGGPGGGNVNGVGMVNGPRTPGDHNNNNNG 281
            :  |.....|.|.   |...|....|:||.     |.|..|         ..||.|       ..
  Rat   180 S--PDESDSVKSEDEDGDMKPAKGQGSQNK-----GSGDDG---------KDPRRP-------KR 221

  Fly   282 PQT--PTGGGSPFAAAAAAAAAAAHMKNQLGASSXNKALGMGAAGAVVPGSGVGAGVGVGVGAAS 344
            |:|  .|.....|.|:...::.......:.                      :.|..|:.|....
  Rat   222 PRTILTTQQRRAFKASFEVSSKPCRKVRET----------------------LAAETGLSVRVVQ 264

  Fly   345 QQFYSGFGLQHQHQHQ----QHHQQQQQQQQLMGLG 376
            ..|      |:|....    :.|||||:||....||
  Rat   265 VWF------QNQRAKMKKLARRHQQQQEQQNSQRLG 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 19/53 (36%)
LIM2_dLMO 156..210 CDD:188776 23/53 (43%)
Lmx1bNP_446161.1 LIM1_Lmx1b 56..108 CDD:188757 20/54 (37%)
LIM2_Lmx1a_Lmx1b 115..169 CDD:188764 23/53 (43%)
Homeobox 222..276 CDD:395001 11/81 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.