DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lmo4a

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_817093.1 Gene:lmo4a / 114412 ZFINID:ZDB-GENE-010702-1 Length:167 Species:Danio rerio


Alignment Length:142 Identity:71/142 - (50%)
Similarity:94/142 - (66%) Gaps:3/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NGNVQSIAAAANNNNNNNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGST 132
            |..|:|.|.|.   ...:....:.|||||..|.||:||.::|..||..||||.||..:|||:|||
Zfish     3 NSRVESSAVAV---TGGSGGAVRSCAGCGGRISDRFLLFSMDRYWHTRCLKCSCCQAQLGEIGST 64

  Fly   133 LYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRF 197
            .::||.::||:.||:||||::|.|:||.:.|||.||||||:.|||||:||.|..|.:|...||||
Zfish    65 CFSKGGMILCRNDYIRLFGHSGACSACGQSIPASEMVMRAQGNVYHLKCFTCATCRNRLVPGDRF 129

  Fly   198 YLCENKILCEYD 209
            :.....|.||:|
Zfish   130 HYVNGTIFCEHD 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 29/53 (55%)
LIM2_dLMO 156..210 CDD:188776 30/54 (56%)
lmo4aNP_817093.1 LIM1_LMO4 24..78 CDD:188772 29/53 (55%)
LIM2_LMO4 88..142 CDD:188773 30/54 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.