DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Lmo1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001369493.1 Gene:Lmo1 / 109594 MGIID:102812 Length:156 Species:Mus musculus


Alignment Length:121 Identity:96/121 - (79%)
Similarity:106/121 - (87%) Gaps:0/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156
            ||||.:.|:|||||:|||..||||||||.||||||||||||||||.||:||:||||||||.||.|
Mouse    24 CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNC 88

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEE 212
            |||||:|||||||||||.|||||:|||||.||.||||||:|:|..|.|||:.||||
Mouse    89 AACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQVDYEE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 42/53 (79%)
LIM2_dLMO 156..210 CDD:188776 41/53 (77%)
Lmo1NP_001369493.1 LIM1_LMO1_LMO3 24..78 CDD:188774 42/53 (79%)
LIM2_LMO1_LMO3 88..142 CDD:188775 41/53 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6117
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 1 1.000 - - otm43750
orthoMCL 1 0.900 - - OOG6_105630
Panther 1 1.100 - - LDO PTHR45787
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5205
SonicParanoid 1 1.000 - - X1872
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.