DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Lmo3

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_036021636.1 Gene:Lmo3 / 109593 MGIID:102810 Length:172 Species:Mus musculus


Alignment Length:161 Identity:104/161 - (64%)
Similarity:121/161 - (75%) Gaps:8/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GGNNG--NGNVQSIAAAANNNNN------NNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKC 119
            ||..|  ...|:..|||..|.::      ..:...:.||||.:.|:|||||:|||..||||||||
Mouse     3 GGRRGCRRKRVERAAAARRNISSIQMLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKC 67

  Fly   120 GCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFAC 184
            .||||||||||||||||.||:||:||||||||.||.||||||:||||||||||:.|||||:||||
Mouse    68 ACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFAC 132

  Fly   185 QQCNHRFCVGDRFYLCENKILCEYDYEERLV 215
            |.||.||||||:|:|..|.|||:.||||.|:
Mouse   133 QLCNQRFCVGDKFFLKNNMILCQTDYEEGLM 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 42/53 (79%)
LIM2_dLMO 156..210 CDD:188776 40/53 (75%)
Lmo3XP_036021636.1 LIM1_LMO1_LMO3 40..94 CDD:188774 42/53 (79%)
LIM2_LMO1_LMO3 104..158 CDD:188775 40/53 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6117
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38552
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2809
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 1 1.000 - - otm43750
orthoMCL 1 0.900 - - OOG6_105630
Panther 1 1.100 - - O PTHR45787
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5205
SonicParanoid 1 1.000 - - X1872
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.