DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Lpxn

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_598913.1 Gene:Lpxn / 107321 MGIID:2147677 Length:386 Species:Mus musculus


Alignment Length:148 Identity:43/148 - (29%)
Similarity:65/148 - (43%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEV--GSTLYTKGNLMLCKRDYLRLFG 151
            |..||.|...|.|: :|.|::..||.:...|..|    |||  ....:.|.....|::|:|.:| 
Mouse   208 SPRCAYCAAPITDK-VLTAMNKTWHPEHFFCSHC----GEVFGAEGFHEKDKKPYCRKDFLAMF- 266

  Fly   152 NTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERL-V 215
             :..|..|::  |..|..:.|...|:|.|||.|..|...|..|. |:..:.:..||..|..|. .
Mouse   267 -SPKCGGCNR--PVLENYLSAMNTVWHPECFVCGDCFSSFSSGS-FFELDGRPFCELHYHHRRGT 327

  Fly   216 FASMANHPMLKRHVSSLG 233
            .......|:..|.:|::|
Mouse   328 LCHDCGQPITGRCISAMG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 16/55 (29%)
LIM2_dLMO 156..210 CDD:188776 17/53 (32%)
LpxnNP_598913.1 LD motif 1 3..15
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..52
LD motif 2 70..82
LD motif 3 92..103
LIM 150..204 CDD:295319
LIM 211..262 CDD:295319 16/55 (29%)
LIM 270..322 CDD:295319 17/54 (31%)
LIM4_Paxillin_like 329..380 CDD:188725 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.