DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Bx and PDLIM5

DIOPT Version :9

Sequence 1:	NP_001259687.1	Gene:	Bx / 32846	FlyBaseID:	FBgn0265598	Length:	424	Species:	Drosophila melanogaster
Sequence 2:	NP_001243355.2	Gene:	PDLIM5 / 10611	HGNCID:	17468	Length:	625	Species:	Homo sapiens

Alignment Length:	141	Identity:	36/141 - (25%)
Similarity:	52/141 - (36%)	Gaps:	25/141 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156
            |..|.:.|... ::.||...||..|..|..|...:.  .:..:.:.....|:.||..|||.  .|
Human   508 CGRCQRKILGE-VISALKQTWHVSCFVCVACGKPIR--NNVFHLEDGEPYCETDYYALFGT--IC 567

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMAN 221
            ..|...|.|.:|.:.|....:|..||.|..|            ||:.        |...|.|..:
Human   568 HGCEFPIEAGDMFLEALGYTWHDTCFVCSVC------------CESL--------EGQTFFSKKD 612

  Fly   222 HPMLKRHVSSL 232
            .|:.|:|..|:
Human   613 KPLCKKHAHSV 623

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Bx	NP_001259687.1	LIM1_LMO1_LMO3	92..146	CDD:188774	11/53 (21%)
Bx	NP_001259687.1	LIM2_dLMO	156..210	CDD:188776	13/53 (25%)
PDLIM5	NP_001243355.2	PDZ_signaling	10..82	CDD:238492
		DUF4749	105..201	CDD:406377
		LIM1_ENH	449..500	CDD:188837
		LIM	508..559	CDD:413332	11/53 (21%)
		LIM3_ENH	567..621	CDD:188843	19/73 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910