DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lhx6

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_002941184.1 Gene:lhx6 / 100493242 XenbaseID:XB-GENE-493341 Length:389 Species:Xenopus tropicalis


Alignment Length:178 Identity:61/178 - (34%)
Similarity:89/178 - (50%) Gaps:7/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SIAAAANNNNNNNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKG 137
            |:.:..:::::..::|..:|:.||..|.|||||:..:::||..||:|..|...|.:..| .|.|.
 Frog    77 SVCSPPSSSSSVPSDGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQHNS-CYIKN 140

  Fly   138 NLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCEN 202
            ..:.||.||...||..  ||.|.:.|.|.:.|.|||.|.|||.||||..|..:...|:.|.|.|.
 Frog   141 KEIFCKMDYFSRFGTK--CARCGRQIYASDWVRRARGNAYHLACFACYSCKRQLSTGEEFGLVEE 203

  Fly   203 KILCEYDYEERLV----FASMANHPMLKRHVSSLGQGSPTGAAGAQNT 246
            |:||...|:..:.    .|...|...|:..|.|.....|..|..|:.:
 Frog   204 KVLCRIHYDTMIENLKRAAENGNGITLEGAVPSEQDSQPKPAKRARTS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 21/53 (40%)
LIM2_dLMO 156..210 CDD:188776 25/53 (47%)
lhx6XP_002941184.1 LIM1_Lhx6 96..149 CDD:188766 21/53 (40%)
LIM2_Lhx6 157..211 CDD:188768 25/53 (47%)
Homeobox 249..302 CDD:365835 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.