DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and ablim2

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_031751181.1 Gene:ablim2 / 100489272 XenbaseID:XB-GENE-490231 Length:672 Species:Xenopus tropicalis


Alignment Length:182 Identity:54/182 - (29%)
Similarity:72/182 - (39%) Gaps:36/182 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GNGNVQSIAAAANNNNNNNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGS 131
            |:||. .|.|..|            |.|||..|::...|.||:..||..|.||..|...|   .:
 Frog   143 GSGNF-CIQALRN------------CGGCGLEIKNGQSLVALEKHWHLGCFKCKTCGMPL---KA 191

  Fly   132 TLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDR 196
            ...:|..:..|:.||...||..  |..|.|.|..  .|:.|....||..|..|.:|:..|..|:.
 Frog   192 EYISKDGIPYCETDYHAKFGIK--CDHCEKFITG--RVLEAGEKHYHPTCACCVRCSQMFAEGEE 252

  Fly   197 FYLCENKI---LC-------EYDYEERLVFASMANHPMLKRHVSSLGQGSPT 238
            .||..|.|   :|       |.:.|.|....|:.:.|      :|...|||:
 Frog   253 MYLQGNSIWHPICRQAAKTEERNKETRTSSESIISVP------ASSTSGSPS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 17/53 (32%)
LIM2_dLMO 156..210 CDD:188776 19/63 (30%)
ablim2XP_031751181.1 LIM1_abLIM 26..77 CDD:188713
LIM2_abLIM 82..137 CDD:188714
LIM3_abLIM 155..206 CDD:188715 17/53 (32%)
LIM4_abLIM 214..269 CDD:188716 18/56 (32%)
AbLIM_anchor 278..636 CDD:406566 7/27 (26%)
VHP 637..672 CDD:128458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.