DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lhx9

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_004913801.1 Gene:lhx9 / 100489035 XenbaseID:XB-GENE-492044 Length:398 Species:Xenopus tropicalis


Alignment Length:163 Identity:64/163 - (39%)
Similarity:82/163 - (50%) Gaps:19/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLG-EVGSTLYTKGNLMLCKRDYLRLFGNTG 154
            ||||||..|.|||.|.|:|..||..|||  ||:|:|. |...|.:.|...:.||.||.|.| :..
 Frog    71 LCAGCGGKISDRYYLLAVDKQWHLRCLK--CCECKLALESELTCFAKDGSIYCKEDYYRRF-SVQ 132

  Fly   155 YCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILC--------EYDYE 211
            .||.|...|.|.|||||||.:||||.||.|..||.....||.|.:.||.:.|        :.|:.
 Frog   133 RCARCHLGISASEMVMRARESVYHLSCFTCTTCNKTLSTGDHFGMKENLVYCRIHFELLVQGDFH 197

  Fly   212 ERLVFASM-------ANHPMLKRHVSSLGQGSP 237
            ::|.:..:       |..|.......::.:|.|
 Frog   198 QQLNYTELSAKGGGIATLPYFSNGTGTVQKGRP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 26/54 (48%)
LIM2_dLMO 156..210 CDD:188776 27/61 (44%)
lhx9XP_004913801.1 LIM1_Lhx2 62..125 CDD:188853 27/55 (49%)
LIM2_Lhx2_Lhx9 130..188 CDD:188763 27/57 (47%)
Homeobox 272..325 CDD:365835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.