DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and arx

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:358 Identity:79/358 - (22%)
Similarity:96/358 - (26%) Gaps:171/358 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSN-------QQQQQQQQSQQSNAGMNSGGQNNGPNPNGNGNVVN-------VVNSGGAGGGNNG 67
            |||       :||..|.|||||        |...| |.|.|....       :::|..|    :|
 Frog   226 SSNPNRAHLQEQQHPQFQSQQS--------QQQQP-PPGCGTDAELSPKEELMLHSSDA----DG 277

  Fly    68 NGNVQSIAAAANNNNNNNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGST 132
            .....|:..:|         ||....|..|..|.||                           .|
 Frog   278 KDGEDSVCLSA---------GSDSEEGMLKRKQRRY---------------------------RT 306

  Fly   133 LYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMR-----ARTNVYHLECFACQQCNHRFC 192
            .:|...|    .:..|.|..|.|    ..|....|:.||     ||..|:    |..::...|  
 Frog   307 TFTSYQL----EELERAFQKTHY----PDVFTREELAMRLDLTEARVQVW----FQNRRAKWR-- 357

  Fly   193 VGDRFYLCENKILCEYDYEERLVFASMANHPMLKRHVSSLGQGSPTGAAGAQNTAGGLLGGGPGG 257
                                             ||.           .||||..|.||...||  
 Frog   358 ---------------------------------KRE-----------KAGAQTHAPGLPFPGP-- 376

  Fly   258 GNVNGVGMVNGPRTPGDHNNNNNGPQTPTGGGSPF------------AAAAAAAAAAAHMKNQLG 310
                         ....|      |..|....|||            |||||||||...:.....
 Frog   377 -------------LSASH------PLGPYLDASPFPPHHPALDSAWTAAAAAAAAAFPSLPPPPH 422

  Fly   311 ASSXNKALGMGAAGAVVPGSGVGAGVGVGVGAA 343
            .|            |.:|.||...|:...:|||
 Frog   423 GS------------AALPPSGSPLGLSTFLGAA 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 8/53 (15%)
LIM2_dLMO 156..210 CDD:188776 9/58 (16%)
arxXP_002933659.1 Homeobox 305..358 CDD:365835 16/99 (16%)
OAR 500..518 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.