DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and si:dkey-90l8.3

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_002663297.3 Gene:si:dkey-90l8.3 / 100330251 ZFINID:ZDB-GENE-081105-149 Length:156 Species:Danio rerio


Alignment Length:138 Identity:69/138 - (50%)
Similarity:96/138 - (69%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNT 153
            |:.|||||..|.||:||.:::..||..||||.||..:|||:|||.|:|..::||:.||:||||:|
Zfish    13 SRSCAGCGGRISDRFLLFSMERYWHSRCLKCSCCQAQLGEIGSTCYSKSGMILCRTDYIRLFGHT 77

  Fly   154 GYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYE-ERLVFA 217
            |.|:||.:.|||.||||||:.|||||:||:|..|.::...||||:.....|.||:|.. ..|:..
Zfish    78 GACSACGQSIPASEMVMRAQGNVYHLKCFSCATCRNQLVPGDRFHYVNGTIFCEHDRPGAALLNT 142

  Fly   218 SMANHPML 225
            .:.::|:|
Zfish   143 HLQSNPVL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 28/53 (53%)
LIM2_dLMO 156..210 CDD:188776 28/53 (53%)
si:dkey-90l8.3XP_002663297.3 LIM1_LMO4 16..70 CDD:188772 28/53 (53%)
LIM2_LMO4 80..134 CDD:188773 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.