DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and isl2

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001159513.1 Gene:isl2 / 100306962 XenbaseID:XB-GENE-487556 Length:333 Species:Xenopus tropicalis


Alignment Length:150 Identity:54/150 - (36%)
Similarity:78/150 - (52%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 AAANNNNNNNNNGSQLCAGCGKHIQDRYLLR-ALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNL 139
            :||...:.....|..:|.|||.||.|:|:|| :.|:.||..||||..|...|.| ..|.:.:...
 Frog    11 SAAMGEHPKKKAGLAVCVGCGSHILDQYILRVSPDLEWHAACLKCAECSQYLDE-NCTCFVRDGK 74

  Fly   140 MLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKI 204
            ..|||||:|||  :..|..|...:|..|:|||....|||.:||.|..|:.|...|:...|.:..:
 Frog    75 TYCKRDYIRLF--SARCPRCQGTLPRSELVMRVGERVYHTDCFRCSVCSRRLLPGEEISLRDQDL 137

  Fly   205 LC--EYDYEERLVFASMANH 222
            ||  |::..:....:|:.:|
 Frog   138 LCGAEHNLSDSGRPSSLRSH 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 24/54 (44%)
LIM2_dLMO 156..210 CDD:188776 20/55 (36%)
isl2NP_001159513.1 LIM1_Isl 27..81 CDD:188752 24/54 (44%)
LIM2_Isl 89..143 CDD:188760 19/53 (36%)
HOX 165..221 CDD:197696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.