DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and tgfb1i1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_012825390.2 Gene:tgfb1i1 / 100038241 XenbaseID:XB-GENE-493249 Length:503 Species:Xenopus tropicalis


Alignment Length:144 Identity:45/144 - (31%)
Similarity:64/144 - (44%) Gaps:9/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156
            ||.|...|... ::.||...||.:...|..|...:||.|  .:.|.....|..||.||||  ..|
 Frog   329 CALCELPIVQN-MVTALGCTWHPEHFCCKVCKKPIGEEG--FHEKDGEQYCSDDYFRLFG--AVC 388

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERL-VFASMA 220
            |.||:.:.  |..:.|...::|.:||.|..|:..|..|. |:..|...|||..|..|. ...:..
 Frog   389 AGCSEAVK--ESYISALGGLWHPQCFVCHVCHTPFINGS-FFEHEGLPLCETHYHSRRGSLCAGC 450

  Fly   221 NHPMLKRHVSSLGQ 234
            ..|:..|.|:::|:
 Frog   451 EQPITGRCVTAMGK 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 15/53 (28%)
LIM2_dLMO 156..210 CDD:188776 18/53 (34%)
tgfb1i1XP_012825390.2 Paxillin <61..>117 CDD:397550
LIM1_Paxillin_like 270..322 CDD:259830
LIM2_Paxillin_like 329..380 CDD:188723 15/53 (28%)
LIM3_Paxillin_like 388..440 CDD:188724 18/54 (33%)
LIM4_Paxillin_like 447..498 CDD:188725 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.