DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and RNF17

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_011533454.1 Gene:RNF17 / 56163 HGNCID:10060 Length:1699 Species:Homo sapiens


Alignment Length:149 Identity:28/149 - (18%)
Similarity:53/149 - (35%) Gaps:45/149 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 WSKSVMKRGTGDFRVWDIVLAPYQGRYHRAKIVDIFRCRYRVYFLDFGITEYTSKKNL------- 351
            |.|.......|...:|           :|.|::::.....||.:||.|.||...:.:|       
Human  1305 WKKGEACAVRGSDTLW-----------YRGKVMEVVGGAVRVQYLDHGFTEKIPQCHLYPILLYP 1358

  Fly   352 ---TFCYELEKAQHNLAFRFEILGTRRQCPIPYINILEGIKHLEHTVLRSDINVRIHNILKDGGY 413
               .||...:  .||..            |:..:...:.|:.|:..:.:..:::          :
Human  1359 DIPQFCIPCQ--LHNTT------------PVGNVWQPDAIEVLQQLLSKRQVDI----------H 1399

  Fly   414 VIRLMKHIHECHMIHLFDD 432
            ::.|.|:..|...|||:.|
Human  1400 IMELPKNPWEKLSIHLYFD 1418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 9/40 (23%)
RNF17XP_011533454.1 TUDOR 446..>553 CDD:278965
TUDOR 702..870 CDD:278965
TUDOR 758..852 CDD:119391
TUDOR 990..1106 CDD:278965
TUDOR 1043..1089 CDD:119391
TUDOR 1253..1371 CDD:278965 16/78 (21%)
TUDOR 1308..1353 CDD:119391 12/55 (22%)
TUDOR 1486..1626 CDD:278965
TUDOR 1560..1607 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.