DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and tdrd5

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_021325008.1 Gene:tdrd5 / 557999 ZFINID:ZDB-GENE-050208-502 Length:908 Species:Danio rerio


Alignment Length:146 Identity:32/146 - (21%)
Similarity:56/146 - (38%) Gaps:28/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 PKRRERGSIVRVHVTRIVSHAEFYARFADGPTVPTWSKSVMKRGT--------GDFRVWD----- 310
            |..|:...::.|.|.:..|.:.||.||:...........:::..:        ..:|:.|     
Zfish   462 PVHRKERELLPVLVEQTESPSYFYIRFSQNKEARALENMMIEMRSCYSYPDVAERYRLPDAYVRP 526

  Fly   311 ---IVLAPYQGRYHRAKIVDIF-RCRYRVYFLDFGITEYTSKKNLTF---CYELEKAQHNLAFRF 368
               ..:||....::|..|.::| ....:||::|:|......:.:|.|   ||....||   |...
Zfish   527 GQVCCVAPRDMWFYRVVIHEVFSETEVKVYYVDYGDITKVERHSLRFLKACYADLPAQ---AVPA 588

  Fly   369 EILGTRRQCPIPYINI 384
            .:.|.|     |..||
Zfish   589 MLAGVR-----PITNI 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 10/49 (20%)
tdrd5XP_021325008.1 LOTUS_1_TDRD5 3..97 CDD:193599
LOTUS_2_TDRD5 133..202 CDD:193589
LOTUS_3_TDRD5 289..364 CDD:193590
TUDOR 472..592 CDD:306940 25/122 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.