DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and tdrd1

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_021335784.1 Gene:tdrd1 / 553522 ZFINID:ZDB-GENE-070803-1 Length:1201 Species:Danio rerio


Alignment Length:253 Identity:46/253 - (18%)
Similarity:86/253 - (33%) Gaps:84/253 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 CAYMIDAAKYTNMSGME--RIFALPDDLKKLPALTIKCRLVNVAQM-------------HIFITQ 199
            |...||   :.|...:|  |:..:..:|..|....|.|.|..:..:             |:...:
Zfish   510 CVGYID---FGNSEEVELNRLRPISKELLALATQAIPCSLAGIKSLTDTWSDEAVLMLKHLVCNR 571

  Fly   200 NVRLRVLGSNGLELLVALIRNRTN----------------IRKI----------PSAQLPPISGD 238
            .:|:.:||......||::|...::                |..:          .|.::||:|..
Zfish   572 FIRVEILGKKDGRALVSMIDESSDPQASVTELLVNMGFAAIESVETKKNEPDPATSTEIPPLSQP 636

  Fly   239 EYGNMDANDREVAKSFARYRPKRRERGSIVRVHVTRIVSHAEFYA---RFADGPTVPTWSKSVMK 300
            ....::....|:...           |..|.:.::.:.|..|||.   ...|..|:...|..:||
Zfish   637 VVEKLEWTGAELPFD-----------GQKVELVISTLKSLDEFYCYNYSKTDEHTLTEMSFELMK 690

  Fly   301 RGTGDFRVWDIVLAPY--------------QGRYHRAKIVDIFRC---RYRVYFLDFG 341
            ....:       .||:              ..|::||.::::  |   :.||.|:|:|
Zfish   691 HCESE-------RAPFTPIVGEPCCALFTGDARWYRAMVLEV--CGEGKARVCFVDYG 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 11/49 (22%)
tdrd1XP_021335784.1 zf-MYND 83..119 CDD:307734
TUDOR 210..318 CDD:306940
TUDOR 429..548 CDD:306940 11/40 (28%)
TUDOR 652..770 CDD:306940 22/97 (23%)
TUDOR 908..1020 CDD:306940
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.