DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and tdrd7

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001011355.2 Gene:tdrd7 / 496822 XenbaseID:XB-GENE-944683 Length:1088 Species:Xenopus tropicalis


Alignment Length:305 Identity:57/305 - (18%)
Similarity:102/305 - (33%) Gaps:70/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 YTNMSGMERIFALPDDLKKLPALTIKCRLVNVAQMHIFITQNVRLRV--LGSNGLELLVALIRNR 221
            ::.:..:.::..|......||....||||   |.:..|...::.::.  |.:.|..|.|.::...
 Frog   543 FSEIVDITKVCKLGKQFYTLPFQATKCRL---AGLEAFCDDSIIIKALELKACGKILAVEILEKS 604

  Fly   222 TNIRKIPSAQLPPISGDEYGNMDAN------DREVAKSFARYRPKRRERGSIVRVHVTRIVSHAE 280
            ..    |...|...|||:..|::|.      ||.::...       :...|...|.||.:.|...
 Frog   605 EK----PLVVLYDTSGDDDININAACLKELCDRSLSLQL-------KANSSFSNVIVTNVCSDGT 658

  Fly   281 FYARFADGPTVPTW-------SKSVMKRGTGDFRV-----WDIVLAPYQGRYHRAKIVDIFRCR- 332
            .:.:.........:       |:...|:.|....|     ..|.|..|:|::.|.:|..:...| 
 Frog   659 LFCQLPSKGLAKLYETLQKVDSEFQSKQVTSHLYVSLPFCGKICLYHYKGKWARVEITSVHSSRA 723

  Fly   333 YRVYFLDFGITEYTSKKNLTFCYELEKAQHNLAFRFEILGTRRQCPIPYINILEGIKHLEHTVLR 397
            ..|.|||.|.........|                       ::.|.|.:..|..|.........
 Frog   724 LDVQFLDSGTIASVKVSEL-----------------------KEIPPPLLRDLISIPPQALRCCL 765

  Fly   398 SDINVRI------------HNILKDGGYVIRLMKHIHECHMIHLF 430
            :|:.:||            :.:|......||::|.....:|:|::
 Frog   766 ADLPLRIGMWTPDAVLWLRNTVLNCLECSIRVVKVDEATNMVHIY 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 12/41 (29%)
tdrd7NP_001011355.2 LabA_like_C 7..93 CDD:387402
LabA_like_C 232..298 CDD:387402
LOTUS_3_TDRD7 342..407 CDD:193588
TUDOR 459..572 CDD:366171 7/31 (23%)
TUDOR 647..766 CDD:366171 25/141 (18%)
TUDOR 905..1015 CDD:366171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.